GLP-1 (Cagrilintide)

89.00
        SPECIAL OFFER

          Please select all product options

          Product was out of stock

          share

          Pure Health Peptides products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law. By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research.

          Pure Health Peptides products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law. By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research.

          Description

          GLP-1 (Cagrilintide)

          This is a synthetic peptide analog supplied in lyophilized powder form for use in qualified laboratory environments. The compound is intended for in vitro and analytical research applications involving peptide interaction and assay-based systems under controlled experimental conditions. This material is provided strictly for research use only and has not been evaluated for clinical, therapeutic, or diagnostic use.

           

          Research Area:

          Metabolics

          Chemical Information:

          • Molecular Formula: C194H312N54O59S2
          • Molecular Weight: 4409.01 g/mol
          • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP  *)
          • *) Note: Where “X” denotes a non-standard or modified N-terminal residue (γ-glutamyl-linked moiety) as defined by the compound structure.
          • Molecular Structure:
          Molecular structure of GLP-1 peptide analog, showcasing its complex arrangement of atoms and bonds, relevant for metabolic research applications.

          Product Description:

          This is a synthetic peptide analog supplied in lyophilized powder form for use in qualified laboratory environments. The compound is intended for in vitro and analytical research applications involving peptide interaction and assay-based systems under controlled experimental conditions. This material is provided strictly for research use only and has not been evaluated for clinical, therapeutic, or diagnostic use.

          Product Designation Note:

          This product is identified using an internal designation for cataloging and differentiation purposes. It is not marketed, labeled, or represented as any approved pharmaceutical or therapeutic compound..

          Research Applications:

          In laboratory research settings, this peptide analog is utilized in controlled experimental systems to support investigation of:

          • Peptide interaction characterization in defined assay systems
          • Receptor binding interaction modeling in controlled experimental environments
          • Structure–property relationship analysis
          • Stability, degradation, and binding behavior under experimental conditions
          • Comparative evaluation of peptide analog modifications

          These research activities are conducted in non-clinical, non-therapeutic contexts.

          Storage and Handling:

          • Store the lyophilized powder at -20°C.
          • Once reconstituted, store at 2-8°C and use promptly.
          • Maintain aseptic handling practices to ensure product quality and sterility.

          Product Specifications:

          • Purity: ≥99% (HPLC Certified)
          • Appearance: Lyophilized white powder
          • Solubility: Soluble in suitable laboratory agents

          Compliance Notice:

          This compound is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.