FOXO4-DRI

469.00
        SPECIAL OFFER

          Please select all product options

          Product was out of stock

          share

          Pure Health Peptides products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law. By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research.

          Pure Health Peptides products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law. By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research.

          Description

          FOXO4-DRI

          FOXO4-DRI (FOXO4 D-Retro-Inverso) is a synthetic peptide engineered in a D-retro-inverso configuration based on a defined peptide sequence. The retro-inverso design and D-residue composition are utilized in research to examine peptide stability and interaction characteristics in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research.

           

          Product Name:

          FOXO4-DRI (FOXO4 D-Retro-Inverso)

          Chemical Information:

          • Molecular Formula: C228H388N86O64
          • Molecular Weight: ~5358 g/mol
          • Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (D-amino acids; retro-inverso)
          • Structure Class: Synthetic peptide (D-retro-inverso configuration)

          Molecular Structure:

          Molecular structure of FOXO4-DRI (FOXO4 D-Retro-Inverso) synthetic peptide, depicting its D-retro-inverso configuration and chemical composition for laboratory research use.

          Product Description:

          FOXO4-DRI (FOXO4 D-Retro-Inverso) is a synthetic peptide engineered in a D-retro-inverso configuration based on a defined peptide sequence. The retro-inverso design and D-residue composition are utilized in research to examine peptide stability and interaction characteristics in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research.

          Research Applications:

          FOXO4-DRI is utilized in controlled laboratory research settings for applications such as:

          • Evaluation of D-retro-inverso peptide behavior in stability and interaction assays
          • Investigation of peptide–protein binding interactions in defined assay systems
          • Comparative analysis of L- and D-configured peptide structures under controlled conditions
          • Development of in vitro assay systems for studying peptide interaction characteristics

          Storage and Handling:

          • Store lyophilized powder at −20 °C until use
          • Once reconstituted, store at 2–8 °C and use promptly
          • Maintain aseptic technique during handling

          Product Specifications:

          • Purity: ≥99% (HPLC/LC-MS Verified)
          • Appearance: Lyophilized white powder
          • Solubility: Soluble in suitable laboratory agents

          Compliance Notice:

          FOXO4-DRI is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.